PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB04G32930.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 799aa    MW: 87328.4 Da    PI: 6.4766
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB04G32930.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.8e-20102158157
                   TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
      Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                   +++ +++t++q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  OB04G32930.1 102 KKRYHRHTQHQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 158
                   688999************************************************995 PP

2START2083.6e-652965211206
                   HHHHHHHHHHHHHHHHC-TT-EEEE.........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SEEE CS
         START   1 elaeeaaqelvkkalaeepgWvkss.........esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetlakae 80 
                   ela +a++elv++a++eep+W+  +         e +n++e+ + f+++ +      ++ea+r+s+vv+m++a+lve+l+d ++    +++ + +a+
  OB04G32930.1 296 ELAVAAMEELVRMAQLEEPLWSAAApaldapaalETLNEEEYARMFPRGLGpkqygLRSEASRDSAVVIMTHANLVEILMDANQyaaVFSNIVSRAA 392
                   57899*******************999*99999999**********998779*******************************66666666666*** PP

                   EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
         START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                   tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q ++g+w++vdvS++s ++ p    v +++++pSg+li++++ng+skvtwvehv
  OB04G32930.1 393 TLEVLSTGvagnynGALQVMSVEFQVPSPLVPtRESYFVRYCKQNSDGTWAVVDVSLESLRPSP----VLKCRRRPSGCLIQEMPNGYSKVTWVEHV 485
                   **************************************************************98....7**************************** PP

                   E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
         START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                   ++++r++h++++ lv+sgla+ga++wv tl+rqce+
  OB04G32930.1 486 EVDDRSVHNIYKLLVNSGLAFGARRWVGTLDRQCER 521
                   **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-2282157IPR009057Homeodomain-like
SuperFamilySSF466896.68E-2089159IPR009057Homeodomain-like
PROSITE profilePS5007117.0799159IPR001356Homeobox domain
SMARTSM003892.3E-20100163IPR001356Homeobox domain
CDDcd000861.40E-19101160No hitNo description
PfamPF000466.5E-18102157IPR001356Homeobox domain
PROSITE patternPS000270134157IPR017970Homeobox, conserved site
PROSITE profilePS5084841.535287524IPR002913START domain
SuperFamilySSF559614.46E-34289523No hitNo description
CDDcd088755.17E-120291520No hitNo description
SMARTSM002343.3E-59296521IPR002913START domain
PfamPF018523.7E-55297521IPR002913START domain
Gene3DG3DSA:3.30.530.201.6E-6361517IPR023393START-like domain
SuperFamilySSF559618.93E-22542720No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MMIPARHMPS MIGRNSAAYG SSSALSLSQP NLLDNHQFQQ AFQQQQHLLD QIPATTAESG  60
DNMIRSRASD PLGGDEFESK SGSENVDGVS VDDQDPNQRP RKKRYHRHTQ HQIQEMEAFF  120
KECPHPDDKQ RKELSRELGL EPLQVKFWFQ NKRTQMKNQH ERHENSQLRS ENEKLRAENM  180
RYKEALSSAS CPNCGGPAAL GEMSFDEHHL RIENARLREE IDRISAIAAK YVGKPMVPFP  240
VLSNPLAAAA SRAAPLDLPM APYGGVVPGD MFGGGASAGE LLRGVQSEVD KPMIVELAVA  300
AMEELVRMAQ LEEPLWSAAA PALDAPAALE TLNEEEYARM FPRGLGPKQY GLRSEASRDS  360
AVVIMTHANL VEILMDANQY AAVFSNIVSR AATLEVLSTG VAGNYNGALQ VMSVEFQVPS  420
PLVPTRESYF VRYCKQNSDG TWAVVDVSLE SLRPSPVLKC RRRPSGCLIQ EMPNGYSKVT  480
WVEHVEVDDR SVHNIYKLLV NSGLAFGARR WVGTLDRQCE RLASVMASNI PTSDIGVITS  540
AEGRKSMLKL AERMVMSFCG GVTASVAHQW TTLSGSGAED VRVMTRKSVD DPGRPPGIVL  600
NAATSFWLPV PPKRVFDFLR DESSRSEWDI LSNGGIVQEM AHIANGRDQG NCVSLLRVNS  660
SNSNQSNMLI LQESCTDASG SYVIYAPVDV VAMNVVLNGG DPDYVALLPS GFAILPDGPG  720
HGGGXXXXXX XXXXXXXXXX XRRRLRRVPP DGGVPDTGRL GPHGEALSGV GGDGEQPHRL  780
HGGAHQGGRL RREQSAVAS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1016450.0AB101645.1 Oryza sativa Japonica Group Roc2 mRNA for GL2-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006652859.10.0PREDICTED: homeobox-leucine zipper protein ROC2
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLJ3M1L80.0J3M1L8_ORYBR; Uncharacterized protein
STRINGOB04G32930.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein